DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and SH3GL1

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_003016.1 Gene:SH3GL1 / 6455 HGNCID:10830 Length:368 Species:Homo sapiens


Alignment Length:249 Identity:60/249 - (24%)
Similarity:97/249 - (38%) Gaps:73/249 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNH---------DWYY-----GRITRADA 70
            |..::...|::|...|:    :|..:.|...:..|:::|         |:.|     |:|...:.
Human   123 RLAEVKDSLDIEVKQNF----IDPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEEL 183

  Fly    71 EKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNELVEYHR 135
            .:.|....|..   .::|:|.  .:|.....:.|.....|.|||..:....|:.  |:||.|..:
Human   184 RQALEKFEESK---EVAETSM--HNLLETDIEQVSQLSALVDAQLDYHRQAVQI--LDELAEKLK 241

  Fly   136 -------------------------------------------TASVSRSQDVKL----RDMIP- 152
                                                       .:|..||.|..:    |.|.| 
Human   242 RRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPL 306

  Fly   153 EEMLVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPATYV 206
            ::...:|||||.|:..|||.|..|||||:|::.||||:.|.:..:.|.||.:||
Human   307 DQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDGQSGFFPLSYV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 6/32 (19%)
SH2_Grb2_like 56..149 CDD:199828 24/153 (16%)
SH3_GRB2_like_C 156..208 CDD:212739 26/51 (51%)
SH3GL1NP_003016.1 Membrane-binding amphipathic helix. /evidence=ECO:0000250 1..21
BAR_Endophilin_A 25..247 CDD:153276 27/134 (20%)
Required for dimerization upon membrane association. /evidence=ECO:0000250 60..87
Interaction with ARC. /evidence=ECO:0000250 218..254 9/37 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 244..308 7/63 (11%)
SH3_Endophilin_A 309..363 CDD:212737 26/52 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.