DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Stam2

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_062641.1 Gene:Stam2 / 56324 MGIID:1929100 Length:523 Species:Mus musculus


Alignment Length:133 Identity:37/133 - (27%)
Similarity:65/133 - (48%) Gaps:10/133 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNELVEYHRTASV 139
            |.|.||     ::..|.|..:::....:|.   .:.::.:.:.....::.:...:..:|..|.::
Mouse   135 SMKEEG-----VTFPSAGSQTVAAAAKNGT---SLNKNKEDEDIAKAIELSLQEQKQQYTETKAL 191

  Fly   140 SRSQDVKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPAT 204
            ....:.:|.:.....  |:|||||...|..||.|:.|::|||.|.||.|||.||.....|:||:.
Mouse   192 YPPAESQLNNKAARR--VRALYDFEAVEDNELTFKHGELITVLDDSDANWWQGENHRGTGLFPSN 254

  Fly   205 YVT 207
            :||
Mouse   255 FVT 257

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..149 CDD:199828 10/73 (14%)
SH3_GRB2_like_C 156..208 CDD:212739 27/52 (52%)
Stam2NP_062641.1 VHS_STAM 9..143 CDD:239625 4/12 (33%)
PxVxL motif 54..67
UIM 166..181 CDD:280900 0/14 (0%)
SH3_STAM2 204..260 CDD:212896 27/56 (48%)