DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and ptk6a

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_682778.6 Gene:ptk6a / 555232 ZFINID:ZDB-GENE-081105-117 Length:563 Species:Danio rerio


Alignment Length:218 Identity:56/218 - (25%)
Similarity:96/218 - (44%) Gaps:44/218 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 FSATADDELSFRKTQILKILNMEDDSNWYRAELDGKE------GLIPSNYI----EMKNHDWYYG 63
            :.|...|||||::.:..:|  .|....|:.|...|::      |.:|::::    .:|...||:|
Zfish   117 YKARGADELSFQEGEQFRI--CERQGEWWTALKLGRDGAVTGRGFVPNHFLAR
RQTVKEQPWYFG 179

  Fly    64 RITRADAEKLL--SNKHEGAFLIRISESSPGDFSLSVKCPD---GVQHFKVLRDAQSKFFLWVVK 123
            .:.|.:.|.||  .....||||:|.||.....:.|||...|   .|:|.|:.::....|:|...:
Zfish   180 TLNRFETEILLLAPENDVGAFLVRHSEKDNIGYVLSVLSGDRSREVKHIKIHQNQNESFYLDKSQ 244

  Fly   124 -FNSLNELVEYHRTASVS----RSQDVKLRDMIPEEMLVQALYDF-VPQESGELDFRRGDVITVT 182
             |.||.:||:|:...|:.    ..|..:..:..|:::....:.|: :|:|...|:          
Zfish   245 TFQSLEKLVDYYWKYSL
DGDSFLKQPCRRPEPKPKDLSHSTVNDWELPKEEFTLE---------- 299

  Fly   183 DRSDENWWNGEIGNRKGIFPATY 205
                     .|:|  ||.|...|
Zfish   300 ---------EELG--KGFFADVY 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 13/49 (27%)
SH2_Grb2_like 56..149 CDD:199828 32/102 (31%)
SH3_GRB2_like_C 156..208 CDD:212739 10/51 (20%)
ptk6aXP_682778.6 SH3_Brk 110..167 CDD:212781 13/51 (25%)
SH2 174..261 CDD:214585 29/86 (34%)
PKc_like 289..541 CDD:328722 9/44 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.