DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and grapa

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001018409.1 Gene:grapa / 553596 ZFINID:ZDB-GENE-050522-347 Length:214 Species:Danio rerio


Alignment Length:214 Identity:102/214 - (47%)
Similarity:140/214 - (65%) Gaps:4/214 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGRI 65
            |||:|.::|.||..|||||:|..:|||.|||||.|||.||...::|.:|.|||.::.|.|:.|||
Zfish     1 MEAVALYNFCATESDELSFQKGDVLKITNMEDDPNWYTAEFVNRKGYVPKNYISLRPHAWFAGRI 65

  Fly    66 TRADAEKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNEL 130
            :|..||..|..:..|:||:|.|||:||:||:||...|.|||||||:|.:..:|:|...|.|||:|
Zfish    66 SRHVAENRLHQRDCGSFLVRESESAPGEFSMSVSYGDHVQHFKVLKDREGYYFVWEEIFPSLNQL 130

  Fly   131 VEYHRTASVSRSQDVKLRDM---IPEEMLVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNG 192
            |::::|.|:::.:.|.|||:   :.......||:||.|:.:.:|.|.|||||.:.|.||...|.|
Zfish   131 VDFYKTNSIAKERTVFLRDLDHTLKRPHHAHALFDFNPEHNSQLHFLRGDVIDLLDCSDSQRWKG 195

  Fly   193 EIGNRKGIFPATYVTP-YH 210
            ....|.|.||..||.| ||
Zfish   196 RCRGRVGFFPPEYVQPIYH 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 28/50 (56%)
SH2_Grb2_like 56..149 CDD:199828 43/92 (47%)
SH3_GRB2_like_C 156..208 CDD:212739 23/51 (45%)
grapaNP_001018409.1 SH3 2..55 CDD:302595 30/52 (58%)
SH2_Grb2_like 56..149 CDD:199828 43/92 (47%)
SH3_GRB2_like_C 159..211 CDD:212739 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46063
OrthoDB 1 1.010 - - D1091250at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46037
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X588
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.