DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and hck

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001015722.1 Gene:hck / 548439 XenbaseID:XB-GENE-6048191 Length:498 Species:Xenopus tropicalis


Alignment Length:214 Identity:62/214 - (28%)
Similarity:111/214 - (51%) Gaps:32/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAEL--DGKEGLIPSNYI----EMKNHDWYY 62
            :|.:|:......:|:|||..  .:|..::...|:.|.|  ..:||.:||||:    .:::.:||:
 Frog    59 LALYDYDGVHPGDLTFRKGD--HLLLKKESGEWWEAYLISTREEGFVPSNYVARVD
SLESKEWYF 121

  Fly    63 GRITRADAEK-LLSNKHE-GAFLIRISESSPGDFSLSVK-CPDGVQHFKVLRDAQSKFFLWV-VK 123
            ..:.|.:||: |||..:. |||:||.||::.|.|||||: ..|.|:|:|:.......||:.. :.
 Frog   122 KDMGRKEAERQLLSPLNTCGAFMIRDSETTKGSFSLSVRDSGDTVRHYKIRTHEDGGFFISTRIT 186

  Fly   124 FNSLNELVEYH--RTASVSRSQDVKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVITVTDRSD 186
            |.||.|||.::  :.:.:.:...|..:.:.||:...:..:: :|:||..|..:.|          
 Frog   187 FPSLPELVSHYQGKMSGLCQCLTVP
CQTLRPEKPWEKDAWE-IPRESLSLQKKLG---------- 240

  Fly   187 ENWWNGEIGNRKGIFPATY 205
                .|:.|:   ::.|||
 Frog   241 ----TGQFGD---VWLATY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 15/50 (30%)
SH2_Grb2_like 56..149 CDD:199828 34/98 (35%)
SH3_GRB2_like_C 156..208 CDD:212739 10/50 (20%)
hckNP_001015722.1 SH3 57..112 CDD:388381 16/54 (30%)
SH2_Src_family 115..211 CDD:199827 33/95 (35%)
PTKc_Src_like 237..484 CDD:270630 6/33 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.