DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Sla2

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001165589.1 Gene:Sla2 / 499931 RGDID:1562071 Length:263 Species:Rattus norvegicus


Alignment Length:146 Identity:47/146 - (32%)
Similarity:81/146 - (55%) Gaps:16/146 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWY--RAELDGKEGLIPSNYIEMKNHDWYYG 63
            :.|:|...|.|.....||.|..:.|.|::  :|.:|:  ::|:.|:|..|||.|:...:|.|.|.
  Rat    37 VSAVALGSFPAGEQARLSLRVGEPLTIIS--EDGDWWTVQSEVSGREYHIPSVYVAKVSHGWLYE 99

  Fly    64 RITRADAEK--LLSNKHEGAFLIRISESSPGDFSLSVKCP-----DGVQHFKVLRDAQSKFFLWV 121
            .::|..||:  ||.....||||||.|::..|.:|||::..     |.::|:::.|  ....:|::
  Rat   100 GLSREKAEELLLLPGNPGGAFLIRESQTRRGCYSLSIRLSRPASWDRIRHYRIQR--LDNGWLYI 162

  Fly   122 ---VKFNSLNELVEYH 134
               :.|.||:.|||::
  Rat   163 SPRLTFPSLHALVEHY 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 17/52 (33%)
SH2_Grb2_like 56..149 CDD:199828 29/89 (33%)
SH3_GRB2_like_C 156..208 CDD:212739
Sla2NP_001165589.1 SH3 39..92 CDD:302595 18/54 (33%)
SH2_SLAP 85..187 CDD:198207 32/96 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.