DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and src

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_017953215.1 Gene:src / 496893 XenbaseID:XB-GENE-489820 Length:544 Species:Xenopus tropicalis


Alignment Length:223 Identity:62/223 - (27%)
Similarity:106/223 - (47%) Gaps:46/223 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILN-----MEDDSNWYRAEL-DGKEGLIPSNYI----EMKNH 58
            :|.:|:.:..:.:|||:|.:.|:|:|     |.:...|....| .|:.|.|||||:    .::..
 Frog    89 VALYDYESRTETDLSFKKGERLQIVNNTRPDMREGDWWLARSLSSGQTGYIPSNYVAPSDSIQAE 153

  Fly    59 DWYYGRITRADAEKLLSN--KHEGAFLIRISESSPGDFSLSVKCPD-----GVQHFKVLRDAQSK 116
            :||.|:|||.:||:||.:  ...|.||:|.||::.|.:.|||...|     .|:|:|:.:.....
 Frog   154 EWYLGKITRREAERLLLSLENPRGTFLVRESETTKGAYCLSVSDYDANRGLNVKHYKIRKLDSGG 218

  Fly   117 FFLWV-VKFNSLNELVEY---------HRTASVSRSQDVKLRDMIPEEMLVQALYDFVPQESGEL 171
            |::.. .:|:||.:||.|         ||..:|..:...:.:.:..:..       .:|::|..|
 Frog   219 FYITSRTQFSSLQQLVAYYSKHADGLCHRLTTVCPTAKPQTQGLSKDAW-------EIPRDSLRL 276

  Fly   172 DFRRGDVITVTDRSDENW-------WNG 192
            :.:.|.     ....|.|       |||
 Frog   277 ELKLGQ-----GCFGEVWMGVSVGTWNG 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 18/54 (33%)
SH2_Grb2_like 56..149 CDD:199828 34/109 (31%)
SH3_GRB2_like_C 156..208 CDD:212739 9/44 (20%)
srcXP_017953215.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.