powered by:
Protein Alignment drk and stam2
DIOPT Version :9
Sequence 1: | NP_476858.1 |
Gene: | drk / 36497 |
FlyBaseID: | FBgn0004638 |
Length: | 211 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001007370.2 |
Gene: | stam2 / 492497 |
ZFINID: | ZDB-GENE-041114-64 |
Length: | 509 |
Species: | Danio rerio |
Alignment Length: | 55 |
Identity: | 25/55 - (45%) |
Similarity: | 34/55 - (61%) |
Gaps: | 0/55 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 EEMLVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPATYVT 207
|...|:|||||...|..||.|:.|:::.:.|.||.|||.||.....|:||:.:||
Zfish 204 ESRKVRALYDFEAAEDNELTFKAGELVIILDDSDPNWWKGENHRGVGLFPSNFVT 258
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R571 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.030 |
|
Return to query results.
Submit another query.