DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and EndoA

DIOPT Version :10

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_620122.2 Gene:EndoA / 42265 FlyBaseID:FBgn0038659 Length:369 Species:Drosophila melanogaster


Alignment Length:49 Identity:25/49 - (51%)
Similarity:34/49 - (69%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 QALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPATYV 206
            ||||||.|:..|||.|:..|:||:.:|.|:||:.|.:..|.|.||.:||
  Fly   311 QALYDFEPENPGELAFKENDIITLLNRVDDNWFEGAVNGRTGYFPQSYV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..149 CDD:199828
SH3_GRB2_like_C 156..208 CDD:212739 25/49 (51%)
EndoANP_620122.2 BAR_Endophilin_A 25..246 CDD:153276
SH3_Endophilin_A 312..361 CDD:212737 24/48 (50%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.