DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and lck

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001001596.1 Gene:lck / 414333 ZFINID:ZDB-GENE-040617-1 Length:503 Species:Danio rerio


Alignment Length:222 Identity:75/222 - (33%)
Similarity:113/222 - (50%) Gaps:29/222 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAE--LDGKEGLIPSNYI----EMKNHDWY 61
            ||.|:|  ....|:|.|.|.:.:|||:. ||..||.||  ..|:.|.||.|::    .|:...|:
Zfish    60 AIYKYD--PAHSDDLGFEKGEKMKILDC-DDPEWYMAESLFTGQRGYIPKNFVAK
LNSMETEPWF 121

  Fly    62 YGRITRADA--EKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQ-----HFKVLR-DAQSKFF 118
            |..::|.||  :.|.....:|:||||.||:.||.||:||:..|.:|     |:::.. ||...:.
Zfish   122 YKNLSRNDAMRQLLAPGNTQGSFLIRESETQPGSFSISVRDLDPMQGDIIKHYRIRNMDAGGFYI 186

  Fly   119 LWVVKFNSLNELVE-YHRTASVSRSQDVK-LRDMIPEEMLVQALYDFVPQESGELDFRRGDVITV 181
            ...:.||||:|||: |.|.|....::.|| .:...|::...|..:: ||:||.:|:.|.|.    
Zfish   187 TNKISFNSLSELVKHYSREADGLCTRLVKP
CQTRAPQKPWWQDEWE-VPRESLKLERRLGQ---- 246

  Fly   182 TDRSDENWWNGEIGNR----KGIFPAT 204
             .:..|.|......||    |.:.|.|
Zfish   247 -GQFGEVWMGLYNNNRQVAIKSLKPGT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 22/51 (43%)
SH2_Grb2_like 56..149 CDD:199828 36/102 (35%)
SH3_GRB2_like_C 156..208 CDD:212739 15/53 (28%)
lckNP_001001596.1 SH3_Lck 57..111 CDD:212938 22/53 (42%)
SH2_Src_Lck 116..216 CDD:198225 35/99 (35%)
PTKc_Lck_Blk 230..493 CDD:270652 14/49 (29%)
Pkinase_Tyr 238..487 CDD:285015 10/40 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.