DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and GRAPL

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_016880124.1 Gene:GRAPL / 400581 HGNCID:37240 Length:144 Species:Homo sapiens


Alignment Length:100 Identity:63/100 - (63%)
Similarity:75/100 - (75%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGRI 65
            ||::|.:.|.||..|||:|.|...|||||||||.|||:|||.|.||.||.|||.:|.|.||.|||
Human     1 MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPWYSGRI 65

  Fly    66 TRADAEKLLSNK-HEGAFLIRISESSPGDFSLSVK 99
            :|..||::|..: |.||||||.||||||:||:|||
Human    66 SRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVK 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 31/50 (62%)
SH2_Grb2_like 56..149 CDD:199828 28/44 (64%)
SH3_GRB2_like_C 156..208 CDD:212739
GRAPLXP_016880124.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091250at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X588
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.