DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and grap2b

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_956972.1 Gene:grap2b / 393651 ZFINID:ZDB-GENE-040426-1485 Length:249 Species:Danio rerio


Alignment Length:250 Identity:102/250 - (40%)
Similarity:139/250 - (55%) Gaps:44/250 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGRI 65
            |||..|:||||||.|||||||..::|||...||  |:|||::|.||.:|.|||......||....
Zfish     1 MEATGKYDFSATAGDELSFRKGDVIKILGTNDD--WFRAEINGMEGFVPRNYIVTTFPSWYKENT 63

  Fly    66 TRADAEKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNEL 130
            :|..|:..|..:..|||:||.|:|||||||:||:..:.||||||:||.|.:::||...|.|||:|
Zfish    64 SRQSAQDELMCQPIGAFIIRGSQSSPGDFSISVRHENDVQHFKVMRDRQGRYYLWSEMFTSLNKL 128

  Fly   131 VEYHRTASVSRSQDVKL----------------------------RDMIP--------------E 153
            |:|:...|:|:...|.|                            |.:.|              .
Zfish   129 VDYYTHNSISKQSRVFLLTDQRSSSDFLHRKPTEAPPFRQERQDYRSLAPPVARPSQPSLPPQVS 193

  Fly   154 EMLVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPATYVTP 208
            .:.|:|:|||..:::.||:|:.||||.|.|:||.:||.|.:..|.|:||..|..|
Zfish   194 ALHVRAMYDFTAEDADELNFQAGDVIEVLDQSDRSWWKGVLRGRTGLFPVNYTNP 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 30/50 (60%)
SH2_Grb2_like 56..149 CDD:199828 42/120 (35%)
SH3_GRB2_like_C 156..208 CDD:212739 24/51 (47%)
grap2bNP_956972.1 SH3 2..51 CDD:302595 30/50 (60%)
SH2_Grb2_like 54..147 CDD:199828 42/92 (46%)
SH3 197..248 CDD:302595 24/50 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1091250at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46037
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X588
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.