DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and stam

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_005163512.1 Gene:stam / 386967 ZFINID:ZDB-GENE-031118-123 Length:516 Species:Danio rerio


Alignment Length:84 Identity:29/84 - (34%)
Similarity:43/84 - (51%) Gaps:16/84 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 FNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVITVTDRSDEN 188
            :.|.:.|:..|:|                :...|:|:|||...|..||.|:.|::||:.|.||.|
Zfish   200 YPSTSSLLTSHKT----------------DGRKVRAIYDFEAAEDNELTFKSGEIITILDDSDPN 248

  Fly   189 WWNGEIGNRKGIFPATYVT 207
            ||.||.....|:||:.:||
Zfish   249 WWKGETYQGVGLFPSNFVT 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..149 CDD:199828 4/24 (17%)
SH3_GRB2_like_C 156..208 CDD:212739 25/52 (48%)
stamXP_005163512.1 VHS_STAM 9..142 CDD:239625
SH3_STAM1 215..269 CDD:212897 25/53 (47%)
GAT 306..379 CDD:281166
WWbp <393..482 CDD:304964
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.