DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and sh3gl1b

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_021333879.1 Gene:sh3gl1b / 378838 ZFINID:ZDB-GENE-031001-6 Length:367 Species:Danio rerio


Alignment Length:246 Identity:59/246 - (23%)
Similarity:101/246 - (41%) Gaps:68/246 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 RKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNH---------DWYY-----GRITRADA 70
            |..::...|:::...|:    :|..:||...:..|:::|         |:.|     |:|...:.
Zfish   123 RLAEVKDSLDIDVKQNF----IDPLQGLCDKDLREIQHHLKKLEGRRLDYDYKKKRQGKIPDEEL 183

  Fly    71 EKLLSNKHEGAFLIRIS-----ESSPGDFS-LSVKCPDGVQHFKV---------------LRDAQ 114
            .:.|...||...:..||     |:.....| ||......:|:.:.               ::|||
Zfish   184 RQALEKFHESKEVAEISMYNLLETDIEQVSQLSSLVESQLQYHRQAVQILDELSDKLRDRMKDAQ 248

  Fly   115 S---KFFL----WVVKFNSLNE----------------LVEYHRTASVSRSQDVKLRDMIP-EEM 155
            :   |.::    .|:.|...||                ...||:...::..     :..:| |:.
Zfish   249 TRPRKEYIPKPKPVIDFGETNEQSNGGYTPSSAPPMRNAESYHQFGRITTR-----KPRLPAEQA 308

  Fly   156 LVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPATYV 206
            ..:|||||.|:..|||.|..||:||:|::.||||:.|.:..:.|.||..||
Zfish   309 CCKALYDFEPENEGELGFHEGDIITLTNQIDENWYEGMLRGQSGFFPLNYV 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 6/32 (19%)
SH2_Grb2_like 56..149 CDD:199828 25/150 (17%)
SH3_GRB2_like_C 156..208 CDD:212739 25/51 (49%)
sh3gl1bXP_021333879.1 BAR_Endophilin_A 25..247 CDD:153276 22/127 (17%)
SH3_Endophilin_A 309..362 CDD:212737 25/51 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.