DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Bmx

DIOPT Version :10

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001102486.1 Gene:Bmx / 367786 RGDID:1565643 Length:655 Species:Rattus norvegicus


Alignment Length:133 Identity:30/133 - (22%)
Similarity:48/133 - (36%) Gaps:24/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   903 IKETNMTEGTTKYYYFETNTWHTTYLDGLEILEFPDGQ--TEHRFKDGST----------EVHFP 955
            |:......|||...|.:.|...:.|...|.:|.||..|  .:....||..          |.:.|
  Rat    33 IENVASLUGTTTQDYTQLNELQSRYPHRLVVLGFPCNQFGYQENCSDGEILNSLKYVRPGEGYKP 97

  Fly   956 ----------NGSIRTTNPNSADIAEEWKYPDGTTVIIRKNDDKEINLPNGQVEIHTKAHKRRIY 1010
                      |||  ..:|..:.:.::..|||...|.:.::....:..|..:.:|.....|..|.
  Rat    98 SFTIFQKCVVNGS--DAHPVFSYLKDKLPYPDDDPVTLIQDPKYLVWNPVSRNDISWNFEKFLIG 160

  Fly  1011 PDG 1013
            |:|
  Rat   161 PEG 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..149 CDD:199828
SH3_GRB2_like_C 156..208 CDD:212739
BmxNP_001102486.1 PH_Btk 25..151 CDD:269944 25/119 (21%)
SH2_Tec_Bmx 269..374 CDD:198262
Protein Kinases, catalytic domain 392..647 CDD:473864
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.