DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Blk

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_006252250.1 Gene:Blk / 364403 RGDID:1308859 Length:554 Species:Rattus norvegicus


Alignment Length:184 Identity:56/184 - (30%)
Similarity:98/184 - (53%) Gaps:20/184 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWY--RAELDGKEGLIPSNYI----EMKNHDWYY 62
            :|..|::|..|.:|...|.:.|::|....|  |:  |:.:.|:||.:|||::    .::...|::
  Rat   113 VALFDYAAVNDRDLQVLKGEKLQVLKSTGD--WWLARSLVTGREGYVPSNFVAP
VETLEVEKWFF 175

  Fly    63 GRITRADAEKLL---SNKHEGAFLIRISESSPGDFSLSVK--CPDG--VQHFKVLRDAQSKFFLW 120
            ..|:|.|||:.|   .|| .|:||||.|||:.|.||||||  ...|  |:|:|:.......:::.
  Rat   176 RTISRKDAERQLLAPMNK-AGSFLIRESESNKGAFSLSVKDVTSQGEMVKHYKIRSLDNGGYYIS 239

  Fly   121 V-VKFNSLNELVEYHRTASVSRSQDVKLR--DMIPEEMLVQALYDFVPQESGEL 171
            . :.|.:|..||:::........|.:.|.  :..|:....|..:: :|::|.:|
  Rat   240 PRITFPTLQALVQHYSEKGDGLCQKLTLP
CVNPAPKNPWAQDEWE-IPRQSLKL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 17/50 (34%)
SH2_Grb2_like 56..149 CDD:199828 34/102 (33%)
SH3_GRB2_like_C 156..208 CDD:212739 4/16 (25%)
BlkXP_006252250.1 SH3 111..164 CDD:302595 17/52 (33%)
SH2 169..268 CDD:301589 33/99 (33%)
PKc_like 282..545 CDD:304357 3/12 (25%)
Pkinase_Tyr 290..539 CDD:285015 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.