DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Src42A

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_610191.2 Gene:Src42A / 35524 FlyBaseID:FBgn0264959 Length:1597 Species:Drosophila melanogaster


Alignment Length:83 Identity:34/83 - (40%)
Similarity:50/83 - (60%) Gaps:3/83 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MKNHDWYYGRITRADAEK--LLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKF 117
            :....||:.:|.|.:|||  ||.....||||||.|||...|:||||:..|.|:|:::.:..:..|
  Fly  1205 LNEKSWYFRKIKRIEAEKKLLLPENEHGAFLIRDSESRHNDYSLSVRDGDTVKHYRIRQLDEGGF 1269

  Fly   118 FL-WVVKFNSLNELVEYH 134
            |: ....|.:|.||||::
  Fly  1270 FIARRTTFRTLQELVEHY 1287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..149 CDD:199828 34/82 (41%)
SH3_GRB2_like_C 156..208 CDD:212739
Src42ANP_610191.2 SH2_Src_Src42 1210..1301 CDD:198233 34/78 (44%)
PTKc_Frk_like 1319..1587 CDD:270653
Pkinase_Tyr 1328..1580 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.