DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Srms

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001011961.1 Gene:Srms / 296472 RGDID:1306602 Length:507 Species:Rattus norvegicus


Alignment Length:165 Identity:52/165 - (31%)
Similarity:82/165 - (49%) Gaps:13/165 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDG--KEGLIPSNYIEM------KNHDWY 61
            |.:||:|...:|||..:...|..|. |:....:...|.|  ..||:|..|:..      .:..||
  Rat    73 ALYDFTARCAEELSVSRGDRLYALK-EEGEYIFAQRLSGPPSTGLVPVTYLAK
ATPETPSDQPWY 136

  Fly    62 YGRITRADAEKLLSN--KHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVK- 123
            :..|:|..|::||.:  ...||||||.||||.|.:||||:....|.|:::........:|...: 
  Rat   137 FNGISRTQAQQLLLSPANAPGAFLIRPSESSIGGYSLSVRAQAKVCHYRICMAPSGGLYLQEGRL 201

  Fly   124 FNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQ 158
            |.||:.|:.|::| :....|:..|:..:|:..|.|
  Rat   202 FPSLDALLAYY
KT-NWKLIQNPLLQPCVPQMPLAQ 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 15/49 (31%)
SH2_Grb2_like 56..149 CDD:199828 33/95 (35%)
SH3_GRB2_like_C 156..208 CDD:212739 2/3 (67%)
SrmsNP_001011961.1 SH3 70..124 CDD:302595 16/51 (31%)
SH2 134..212 CDD:301589 29/77 (38%)
PTKc_Srm_Brk 238..498 CDD:133248
Pkinase_Tyr 245..495 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.