DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and GRB2

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_002077.1 Gene:GRB2 / 2885 HGNCID:4566 Length:217 Species:Homo sapiens


Alignment Length:212 Identity:139/212 - (65%)
Similarity:167/212 - (78%) Gaps:4/212 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGRI 65
            ||||||:||.|||||||||::..|||:||.|.|.|||:|||:||:|.||.||||||.|.|::|:|
Human     1 MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPWFFGKI 65

  Fly    66 TRADAEKLLS-NKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNE 129
            .||.||::|| .:|:||||||.|||:|||||||||..:.|||||||||...|:||||||||||||
Human    66 PRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNE 130

  Fly   130 LVEYHRTASVSRSQDVKLRDM--IPEE-MLVQALYDFVPQESGELDFRRGDVITVTDRSDENWWN 191
            ||:|||:.||||:|.:.|||:  :|:: ..||||:||.|||.|||.|||||.|.|.|.||.|||.
Human   131 LVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWK 195

  Fly   192 GEIGNRKGIFPATYVTP 208
            |....:.|:||..||||
Human   196 GACHGQTGMFPRNYVTP 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 35/50 (70%)
SH2_Grb2_like 56..149 CDD:199828 63/93 (68%)
SH3_GRB2_like_C 156..208 CDD:212739 31/51 (61%)
GRB2NP_002077.1 SH3_GRB2_N 1..56 CDD:212879 39/54 (72%)
SH2_Grb2_like 56..150 CDD:199828 63/93 (68%)
SH3_GRB2_C 160..212 CDD:212882 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160170
Domainoid 1 1.000 113 1.000 Domainoid score I6156
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1576
Inparanoid 1 1.050 282 1.000 Inparanoid score I2889
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46063
OrthoDB 1 1.010 - - D1091250at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 1 1.000 - - oto90272
orthoMCL 1 0.900 - - OOG6_107796
Panther 1 1.100 - - LDO PTHR46037
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 1 1.000 - - X588
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.940

Return to query results.
Submit another query.