DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Hck

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_037317.2 Gene:Hck / 25734 RGDID:2785 Length:524 Species:Rattus norvegicus


Alignment Length:220 Identity:60/220 - (27%)
Similarity:109/220 - (49%) Gaps:40/220 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAE--LDGKEGLIPSNYI----EMKNHDWYY 62
            :|.:|:.|...::|||:|...:.:|  |:...|::|.  ...|||.|||||:    .::..:|::
  Rat    82 VALYDYEAIHREDLSFQKGDQMVVL--EESGEWWKARSLATKKEGYIPSNYVARVN
SLETEEWFF 144

  Fly    63 GRITRADAEK--LLSNKHEGAFLIRISESSPGDFSLSVK-----CPDGVQHFKVLRDAQSKFFLW 120
            ..|:|.|||:  |......|:|:||.||::.|.:||||:     ..|.|:|:|:.......|::.
  Rat   145 KGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSLSVRDFDPQHGDTVKHYKIRTLDSGGFYIS 209

  Fly   121 V-VKFNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYD----FVPQESGELDFRRGDVIT 180
            . ..|:||.|||.:::.......|.:.:..:.|:.   |..::    .:|:||.:::.:.|    
  Rat   210 PRSTFSSLQELVVHYKKGKDGLCQKLSVPCVS
PKP---QKPWEKDAWEIPRESLQMEKKLG---- 267

  Fly   181 VTDRSDENWWNGEIGNRKGIFPATY 205
                      .|:.|.   ::.|||
  Rat   268 ----------AGQFGE---VWMATY 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 18/50 (36%)
SH2_Grb2_like 56..149 CDD:199828 30/100 (30%)
SH3_GRB2_like_C 156..208 CDD:212739 10/54 (19%)
HckNP_037317.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 35..71
SH3 80..135 CDD:302595 19/54 (35%)
SH2_Src_HCK 138..241 CDD:198226 30/102 (29%)
PKc_like 252..522 CDD:304357 9/45 (20%)
Pkinase_Tyr 260..509 CDD:285015 6/37 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.