DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and SPBC19C2.10

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_595695.1 Gene:SPBC19C2.10 / 2540758 PomBaseID:SPBC19C2.10 Length:501 Species:Schizosaccharomyces pombe


Alignment Length:205 Identity:43/205 - (20%)
Similarity:65/205 - (31%) Gaps:93/205 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGRITRADAEKLLSNKH 78
            |.:|||::.::          :...||||                            |||.|..:
pombe   367 DIQLSFKQPEL----------SASSAEL
D----------------------------EKLKSQCN 393

  Fly    79 EGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNELVEYHRTASVSRSQ 143
            .......||::.|...:.|...|                                  .||:|..:
pombe   394 VSPSPSNISDAPPSKLNRSYSSP----------------------------------LASISSRK 424

  Fly   144 DVKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGE--------IGNRKGI 200
            .|:::            |.|.|:...||..::||::.|....||.||.||        .|| .|:
pombe   425 VVRMK------------YSFEPETENELKLKKGDLLLVLKEIDEGWWVGEKLGEDGVFTGN-TGM 476

  Fly   201 FPATYVTPYH 210
            ||:.|..|.|
pombe   477 FPSNYCVPAH 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 8/38 (21%)
SH2_Grb2_like 56..149 CDD:199828 13/92 (14%)
SH3_GRB2_like_C 156..208 CDD:212739 20/59 (34%)
SPBC19C2.10NP_595695.1 BAR_MUG137_fungi 21..235 CDD:153277
CENP-T_N <245..384 CDD:292789 5/26 (19%)
SH3 430..482 CDD:302595 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.