DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment drk and hse1

DIOPT Version :9

Sequence 1:	NP_476858.1	Gene:	drk / 36497	FlyBaseID:	FBgn0004638	Length:	211	Species:	Drosophila melanogaster
Sequence 2:	NP_595425.1	Gene:	hse1 / 2540055	PomBaseID:	SPBC1734.08	Length:	373	Species:	Schizosaccharomyces pombe

Alignment Length:	50	Identity:	25/50 - (50%)
Similarity:	32/50 - (64%)	Gaps:	0/50 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   157 VQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPATYV 206
            |:|||||...|.|||.|::||:|.|.:...::||.|...|..||||..||
pombe   220 VRALYDFAATEQGELSFKKGDIILVLESVYKDWWKGSCKNAVGIFPVNYV 269

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
drk	NP_476858.1	SH3_GRB2_like_N	2..53	CDD:212738
		SH2_Grb2_like	56..149	CDD:199828
		SH3_GRB2_like_C	156..208	CDD:212739	24/49 (49%)
hse1	NP_595425.1	VHS	9..140	CDD:197630
		SH3_GRB2_like_C	219..271	CDD:212739	24/49 (49%)
		GAT	297..362	CDD:281166
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	1	1.030	-	avgDist	Average_Evolutionary_Distance	R571
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.030