DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and skb5

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_588016.1 Gene:skb5 / 2539237 PomBaseID:SPCC24B10.13 Length:140 Species:Schizosaccharomyces pombe


Alignment Length:165 Identity:35/165 - (21%)
Similarity:62/165 - (37%) Gaps:44/165 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LIPSNYIEMKNHDWYYG---RITRADAEKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFK 108
            ::..:|:...:|:.:||   |:...:.|:.:.:..:..  |..|:.|           :.:...:
pombe    11 VVGRDYLYPPDHELHYGFHARVIEEEEERFVDDTFDET--IEGSDDS-----------ESIDDTE 62

  Fly   109 VLRDAQSKFFLWVVKFNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYDFVPQESGELDF 173
            |..||:              |....|.:||.:     .|.|.:       |||||.|....||.|
pombe    63 VFYDAE--------------ESESTHPSASFN-----VLADAV-------ALYDFEPLHDNELGF 101

  Fly   174 RRGDVITVTDRSDENWW--NGEIGNRKGIFPATYV 206
            ..|..:.:...|.:.|.  ..:...|.|:.|.|:|
pombe   102 TTGQRLCILSESSDGWLIAYDDASGRSGLVPETFV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 0/5 (0%)
SH2_Grb2_like 56..149 CDD:199828 16/95 (17%)
SH3_GRB2_like_C 156..208 CDD:212739 17/53 (32%)
skb5NP_588016.1 SH3_Nbp2-like 84..138 CDD:212799 18/60 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.