DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and FYN

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001357458.1 Gene:FYN / 2534 HGNCID:4037 Length:537 Species:Homo sapiens


Alignment Length:215 Identity:65/215 - (30%)
Similarity:112/215 - (52%) Gaps:36/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAE--LDGKEGLIPSNYI----EMKNHDWYY 62
            :|.:|:.|..:|:|||.|.:..:||| ..:.:|:.|.  ..|:.|.|||||:    .::..:||:
Human    88 VALYDYEARTEDDLSFHKGEKFQILN-SSEGDWWEARSLTTGETGYIPSNYVAP
VDSIQAEEWYF 151

  Fly    63 GRITRADAEK-LLS-NKHEGAFLIRISESSPGDFSLSVK-----CPDGVQHFKVLRDAQSKFFLW 120
            |::.|.|||: ||| ....|.||||.||::.|.:|||::     ..|.|:|:|:.:.....:::.
Human   152 GKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYIT 216

  Fly   121 V-VKFNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYDF---------VPQESGELDFRR 175
            . .:|.:|.:||:::.    .|:..:..|.::|....:..|.|.         :|:||.:|..|.
Human   217 TRAQFETLQQLVQHYS----ERAAGLCCRLVVP
CHKGMPRLTDLSVKTKDVWEIPRESLQLIKRL 277

  Fly   176 GDVITVTDRSDENW---WNG 192
            |:     .:..|.|   |||
Human   278 GN-----GQFGEVWMGTWNG 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 19/50 (38%)
SH2_Grb2_like 56..149 CDD:199828 30/100 (30%)
SH3_GRB2_like_C 156..208 CDD:212739 13/49 (27%)
FYNNP_001357458.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 14..35
SH3_Fyn_Yrk 85..140 CDD:212939 20/52 (38%)
SH2_Src_Fyn_isoform_a_like 145..245 CDD:198281 31/103 (30%)
PTKc_Fyn 261..534 CDD:270655 11/37 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.