DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Fyn

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_006256584.1 Gene:Fyn / 25150 RGDID:2641 Length:575 Species:Rattus norvegicus


Alignment Length:215 Identity:65/215 - (30%)
Similarity:112/215 - (52%) Gaps:36/215 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAE--LDGKEGLIPSNYI----EMKNHDWYY 62
            :|.:|:.|..:|:|||.|.:..:||| ..:.:|:.|.  ..|:.|.|||||:    .::..:||:
  Rat   126 VALYDYEARTEDDLSFHKGEKFQILN-SSEGDWWEARSLTTGETGYIPSNYVAP
VDSIQAEEWYF 189

  Fly    63 GRITRADAEK-LLS-NKHEGAFLIRISESSPGDFSLSVK-----CPDGVQHFKVLRDAQSKFFLW 120
            |::.|.|||: ||| ....|.||||.||::.|.:|||::     ..|.|:|:|:.:.....:::.
  Rat   190 GKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYIT 254

  Fly   121 V-VKFNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYDF---------VPQESGELDFRR 175
            . .:|.:|.:||:::.    .|:..:..|.::|....:..|.|.         :|:||.:|..|.
  Rat   255 TRAQFETLQQLVQHYS----ERAAGLCCRLVVP
CHKGMPRLTDLSVKTKDVWEIPRESLQLIKRL 315

  Fly   176 GDVITVTDRSDENW---WNG 192
            |:     .:..|.|   |||
  Rat   316 GN-----GQFGEVWMGTWNG 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 19/50 (38%)
SH2_Grb2_like 56..149 CDD:199828 30/100 (30%)
SH3_GRB2_like_C 156..208 CDD:212739 13/49 (27%)
FynXP_006256584.1 SH3_Fyn_Yrk 123..178 CDD:212939 20/52 (38%)
SH2_Src_Fyn_isoform_a_like 183..283 CDD:198281 31/103 (30%)
PTKc_Fyn 299..572 CDD:270655 11/37 (30%)
Pkinase_Tyr 309..558 CDD:285015 8/27 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.