DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and FRK

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_002022.1 Gene:FRK / 2444 HGNCID:3955 Length:505 Species:Homo sapiens


Alignment Length:152 Identity:57/152 - (37%)
Similarity:85/152 - (55%) Gaps:19/152 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAEL----DGK----EGLIPSNYI----EMK 56
            :|..|:.|...::||||....|::|:...:..|:...|    ||.    :|.|||||:    .::
Human    48 VALFDYQARTAEDLSFRAGDKLQVLDTLHEGWWFARHLEKRRDGSSQQLQGYIPSNY
VAEDRSLQ 112

  Fly    57 NHDWYYGRITRADAEK--LLSNKHEGAFLIRISESSPGDFSLSVKCPDG--VQHFKVLRDAQSKF 117
            ...|::|.|.|:||||  |.|....|:||||.|||..|:|||||.  ||  |:|:::.|..:..|
Human   113 AEPWFFGAIGRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVL--DGAVVKHYRIKRLDEGGF 175

  Fly   118 FLWVVK-FNSLNELVEYHRTAS 138
            ||...: |::|||.|.::...|
Human   176 FLTRRRIFSTLNEFVSHYTKTS 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 18/56 (32%)
SH2_Grb2_like 56..149 CDD:199828 38/88 (43%)
SH3_GRB2_like_C 156..208 CDD:212739
FRKNP_002022.1 SH3_Src_like 47..104 CDD:212779 17/55 (31%)
SH2_Src_Frk 112..207 CDD:199831 38/88 (43%)
PTKc_Frk_like 225..494 CDD:270653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.