DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Rasa1

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_663427.2 Gene:Rasa1 / 218397 MGIID:97860 Length:1038 Species:Mus musculus


Alignment Length:160 Identity:41/160 - (25%)
Similarity:84/160 - (52%) Gaps:12/160 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 DELSFRKTQILKILN-MEDDSNWYRAELDGKEGLIPSNYIEMKNHD--------WYYGRITRADA 70
            ||:||.|..:..:.| :||...|.......::|||..:.:|....:        |::|:|::.:|
Mouse   288 DEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLVEEV
GREEDPHEGKIWFHGKISKQEA 352

  Fly    71 EKLLSNKHE-GAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNELVEYH 134
            ..||....: .:||:|.|:::|||:||..:..:.:|.||:.....::|.:....:||:.::::::
Mouse   353 YNLLMTVGQVCSFLVRPSDNTPGDYSLYFRTNENIQRFKICPTPNNQFMMGGRYYNSIGDIIDHY 417

  Fly   135 RTASVSRSQDVKLRDMIPEEMLVQALYDFV 164
            |...:  .:...|::.:|.:...|.|.|.|
Mouse   418 RKEQI--VEGYYLKEPVPMQDQGQVLNDTV 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 12/38 (32%)
SH2_Grb2_like 56..149 CDD:199828 23/101 (23%)
SH3_GRB2_like_C 156..208 CDD:212739 4/9 (44%)
Rasa1NP_663427.2 SH2_Nterm_RasGAP 152..255 CDD:198216
SH3_RasGAP 272..330 CDD:212722 13/41 (32%)
SH2_Cterm_RasGAP 341..417 CDD:198217 21/75 (28%)
PH 480..568 CDD:278594
PH_RASA1 480..567 CDD:270080
C2_Ras_p21A1 582..707 CDD:176045
RasGAP 689..1035 CDD:214617
RasGAP_p120GAP 705..1036 CDD:213340
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.