DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Srms

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_035611.3 Gene:Srms / 20811 MGIID:101865 Length:507 Species:Mus musculus


Alignment Length:208 Identity:66/208 - (31%)
Similarity:96/208 - (46%) Gaps:30/208 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDG--KEGLIPSNYIEM------KNHDWY 61
            |.:||:|...:|||..:...|..|..|.| ..:...|.|  ..||:|..|:..      .:..||
Mouse    73 ALYDFTARCAEELSVSRGDRLYALKEEGD-YIFAQRLSGPPSTGLVPVTYLAK
ATPEPPSDQPWY 136

  Fly    62 YGRITRADAEKLLSN--KHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVK- 123
            :..|:||.|::||.:  ...||||||.||||.|.:||||:....|.|:::........:|...: 
Mouse   137 FSGISRAQAQQLLLSPANAPGAFLIRPSESSIGGYSLSVRAQAKVCHYRICMAPSGSLYLQEGQL 201

  Fly   124 FNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYDFVPQESGELDFRR-------GDVITV 181
            |.||:.|:.|::| :....|:..|:..||:..|||   |...:...|...||       |:|.  
Mouse   202 FPSLDALLAYY
KT-NWKLIQNPLLQPCIPQIPLVQ---DEWERPRSEFVLRRKLGEGFFGEVW-- 260

  Fly   182 TDRSDENWWNGEI 194
                 |..|.|.|
Mouse   261 -----EGLWLGSI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 16/49 (33%)
SH2_Grb2_like 56..149 CDD:199828 34/95 (36%)
SH3_GRB2_like_C 156..208 CDD:212739 13/46 (28%)
SrmsNP_035611.3 SH3 70..124 CDD:302595 17/51 (33%)
SH2_Srm 134..212 CDD:198223 30/77 (39%)
PTKc_Srm_Brk 238..498 CDD:133248 9/38 (24%)
STYKc 246..495 CDD:214568 8/30 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.