DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Src

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_006499126.1 Gene:Src / 20779 MGIID:98397 Length:552 Species:Mus musculus


Alignment Length:231 Identity:63/231 - (27%)
Similarity:110/231 - (47%) Gaps:54/231 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILN----------------MEDDSNWYRAE--LDGKEGLIPS 50
            :|.:|:.:..:.:|||:|.:.|:|:|                ::.:.:|:.|.  ..|:.|.|||
Mouse    89 VALYDYESRTETDLSFKKGERLQIVNNTRKVDVSQTWFTFRWLQREGDWWLAHSLSTGQTGYIPS 153

  Fly    51 NYI----EMKNHDWYYGRITRADAEKLLSNKH--EGAFLIRISESSPGDFSLSVKCPD-----GV 104
            ||:    .::..:||:|:|||.::|:||.|..  .|.||:|.||::.|.:.|||...|     .|
Mouse   154 NYVAPS
DSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNV 218

  Fly   105 QHFKVLRDAQSKFFLWV-VKFNSLNELVEY---------HRTASVSRSQDVKLRDMIPEEMLVQA 159
            :|:|:.:.....|::.. .:||||.:||.|         ||..:|..:...:.:.:..:..    
Mouse   219 KHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTV
CPTSKPQTQGLAKDAW---- 279

  Fly   160 LYDFVPQESGELDFRRGDVITVTDRSDENW---WNG 192
               .:|:||..|:.:.|.     ....|.|   |||
Mouse   280 ---EIPRESLRLEVKLGQ-----GCFGEVWMGTWNG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 17/66 (26%)
SH2_Grb2_like 56..149 CDD:199828 35/109 (32%)
SH3_GRB2_like_C 156..208 CDD:212739 10/40 (25%)
SrcXP_006499126.1 SH3_Src 87..159 CDD:212941 18/69 (26%)
SH2_Src_Src 163..263 CDD:198228 34/99 (34%)
PTKc_Src 276..552 CDD:270656 10/44 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.