DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Ptk6

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_033210.1 Gene:Ptk6 / 20459 MGIID:99683 Length:451 Species:Mus musculus


Alignment Length:153 Identity:52/153 - (33%)
Similarity:89/153 - (58%) Gaps:15/153 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DFSATADDELSFRKTQILKILNMEDDSNWYRAEL---DGK---EGLIPSNYIEMK----NHDWYY 62
            ||.|..|:||||:...:|.:...|:  .|:.|.|   :||   ||.:|.||:..|    :..|::
Mouse    18 DFKARTDEELSFQAGDLLHVTKKEE--LWWWATLLDAEGKALAEGYVPHNYLAE
KETVESEPWFF 80

  Fly    63 GRITRADAEKLL--SNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFL-WVVKF 124
            |.|:|::|...|  .:..:||||||:|:....|:.|||:....|:|:::.::.:.:..| ..|.|
Mouse    81 GCISRSEAMHRLQAEDNSKGAFLIRVSQKPGADYVLSVRDAQAVRHYRIWKNNEGRLHLNEAVSF 145

  Fly   125 NSLNELVEYHRTASVSRSQDVKL 147
            ::|:|||:||:|.|:|....:.:
Mouse   146 SNLSELVDYHKTQSLSHGLQLSM 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 19/50 (38%)
SH2_Grb2_like 56..149 CDD:199828 32/99 (32%)
SH3_GRB2_like_C 156..208 CDD:212739
Ptk6NP_033210.1 SH3 12..69 CDD:302595 20/52 (38%)
SH2_PTK6_Brk 75..174 CDD:198221 31/94 (33%)
Linker 171..190
PKc_like 184..444 CDD:304357
STYKc 192..441 CDD:214568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.