DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and T25B9.4

DIOPT Version :10

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_501994.1 Gene:T25B9.4 / 188882 WormBaseID:WBGene00012010 Length:546 Species:Caenorhabditis elegans


Alignment Length:95 Identity:23/95 - (24%)
Similarity:46/95 - (48%) Gaps:16/95 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 MKNHDWYYGRITRADAEKLLSNKHEGAFLIRISESSPG-----DFSLSVKCP---------DGVQ 105
            :.|..:|:|.:.|.|...:|  |.:|.|:.|::|.:.|     |..||:..|         ..::
 Worm    11 LMNQKFYHGYLPREDLPYVL--KKKGDFIFRVTERTVGKEQKKDIVLSIAWPTESVAMIDTKDIK 73

  Fly   106 HFKVLRDAQSKFFLWVVKFNSLNELVEYHR 135
            ::.:.|.|.|.:....:.|:|::.|..::|
 Worm    74 NYLIERSANSVWLDLKISFHSIDALYNHYR 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..149 CDD:199828 23/94 (24%)
SH3_GRB2_like_C 156..208 CDD:212739
T25B9.4NP_501994.1 SH2_Fps_family 9..109 CDD:198224 23/95 (24%)
PTKc 136..387 CDD:270623
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.