DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and kin-5

DIOPT Version :10

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_501793.1 Gene:kin-5 / 188489 WormBaseID:WBGene00002193 Length:533 Species:Caenorhabditis elegans


Alignment Length:83 Identity:27/83 - (32%)
Similarity:50/83 - (60%) Gaps:9/83 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 WYYGRITRADAEKLLSNKHEGAFLIRISESSPGD---FSLSVKCP--DGVQHFKVLRDAQSKFFL 119
            ||:|.:.|.|.::||:.:  |.||:|.::...|:   |.|||...  :.::|: |:|:..:||.:
 Worm    16 WYHGLLPREDMKQLLTQR--GDFLVRFTDPKVGEPRKFVLSVYVGVIEDIRHY-VIREHNNKFAV 77

  Fly   120 WVVKFNSLNELVE-YHRT 136
            ....|:|:.:|:. |||:
 Worm    78 DKKWFSSIADLLNYYHRS 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..149 CDD:199828 27/83 (33%)
SH3_GRB2_like_C 156..208 CDD:212739
kin-5NP_501793.1 SH2_Fps_family 11..99 CDD:198224 27/83 (33%)
TyrKc 123..376 CDD:197581
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.