Sequence 1: | NP_476858.1 | Gene: | drk / 36497 | FlyBaseID: | FBgn0004638 | Length: | 211 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001276371.1 | Gene: | Grap2 / 17444 | MGIID: | 1333842 | Length: | 322 | Species: | Mus musculus |
Alignment Length: | 321 | Identity: | 105/321 - (32%) |
---|---|---|---|
Similarity: | 146/321 - (45%) | Gaps: | 115/321 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGRI 65
Fly 66 TRADAEKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNEL 130
Fly 131 VEYHRTASVSRSQDVKLRD------------------------MIPEEM---------------- 155
Fly 156 ----------------------------------------------------------------- 155
Fly 156 --------LVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPATYVTP 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drk | NP_476858.1 | SH3_GRB2_like_N | 2..53 | CDD:212738 | 26/50 (52%) |
SH2_Grb2_like | 56..149 | CDD:199828 | 47/92 (51%) | ||
SH3_GRB2_like_C | 156..208 | CDD:212739 | 25/51 (49%) | ||
Grap2 | NP_001276371.1 | SH3 | 2..53 | CDD:302595 | 27/52 (52%) |
SH2_Grb2_like | 54..147 | CDD:199828 | 47/92 (51%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 143..216 | 6/72 (8%) | |||
SH3_GRAP2_C | 267..319 | CDD:212883 | 25/51 (49%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1091250at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000006 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR46037 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X588 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 5.020 |