DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and src-2

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_493502.1 Gene:src-2 / 173296 WormBaseID:WBGene00005078 Length:507 Species:Caenorhabditis elegans


Alignment Length:144 Identity:56/144 - (38%)
Similarity:86/144 - (59%) Gaps:11/144 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWY-RAELDGKEGLIPSNYI----EMKNHDWYYG 63
            :|...:.|..||:|||:|..||:|||......|: |.:..|:.|.|||||:    .:::..||:|
 Worm    63 VALFQYDARTDDDLSFKKDDILEILNDTQGDWWFARHKATGRTGYIPSNY
VAREKSIESQPWYFG 127

  Fly    64 RITRADAEKLL---SNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVK-F 124
            ::.|.||||.|   .|:| ||||:|.|||...|.||||:..|.|:|:::.:.....:|:...: |
 Worm   128 KMRRIDAEKCLLHTLNEH-GAFLVRDSESRQHDLSLSVRENDSVKHYRIRQLDHGGYFIARRRPF 191

  Fly   125 NSLNELV-EYHRTA 137
            .:|::|: .|.|.|
 Worm   192 ATLHDLIAHYQREA 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 21/49 (43%)
SH2_Grb2_like 56..149 CDD:199828 34/87 (39%)
SH3_GRB2_like_C 156..208 CDD:212739
src-2NP_493502.1 SH3_Src_like 61..112 CDD:212779 20/48 (42%)
SH2_Src_Src42 120..215 CDD:198233 34/87 (39%)
PTKc_Frk_like 231..496 CDD:270653
Pkinase_Tyr 240..489 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.