DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and C35E7.10

DIOPT Version :10

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_492826.1 Gene:C35E7.10 / 172988 WormBaseID:WBGene00016462 Length:430 Species:Caenorhabditis elegans


Alignment Length:150 Identity:40/150 - (26%)
Similarity:74/150 - (49%) Gaps:23/150 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EMKNHDWYYGRITRADAEKLLSNKHEGAFLIRISESSPGD---FSLSV--KCPDGVQHFKVLRDA 113
            ::.:..:|:|.:.|.|.:::| || .|.||:|.||...|:   |.|||  :......|| |:|::
 Worm     5 DLLHQKYYHGLLPREDIQEML-NK-PGQFLLRTSEPVKGEKRQFVLSVVGEKKTSANHF-VVRES 66

  Fly   114 QSKFFLWVVKFNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYDFVPQESGELDFRRGDV 178
            ..|.::..:.|.::.|||.::    ||..:....:|...:.:|.||    |.::..||   ..:.
 Worm    67 DHKVYVDKIGFPTIIELVNHY----VSTKESFSTKDGTVKAVLKQA----VERQKWEL---YHED 120

  Fly   179 ITVTDRSDE----NWWNGEI 194
            :.:|.:..|    ..|.|::
 Worm   121 VELTKKLGEGAFGEVWKGKL 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..149 CDD:199828 29/97 (30%)
SH3_GRB2_like_C 156..208 CDD:212739 10/42 (24%)
C35E7.10NP_492826.1 SH2_Fps_family 4..93 CDD:198224 29/94 (31%)
TyrKc 121..376 CDD:197581 4/19 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.