DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and stam-1

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_491710.2 Gene:stam-1 / 172264 WormBaseID:WBGene00004109 Length:457 Species:Caenorhabditis elegans


Alignment Length:258 Identity:59/258 - (22%)
Similarity:91/258 - (35%) Gaps:96/258 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NWYRAELDGKEGLIPSNYIEMKNHDWYYGRITRADAEKLLSNKHEGAFLIRIS------ESSPGD 93
            ||        ||::.  :.:|.|:|:...:.......|.|:|:.....|:.||      .:....
 Worm    28 NW--------EGILA--FCDMINNDFEGSKTGIKSLRKRLNNRDPHVVLLAISVLDSCWANCEER 82

  Fly    94 FSLSVKCPDGVQHFKVL-----RDAQSKFFLWVVKF--------NSLNELVEYHRT--------- 136
            |...|.....:...|.|     |....|..|.|.|:        .||:.:|..|:.         
 Worm    83 FRKEVSSAQFINELKALCTSSQRQVAEKMRLTVQKWVDTECKTEQSLSLIVTLHKNLVADGYSFV 147

  Fly   137 ---------------------------------------------------------ASVSRSQD 144
                                                                     ::.:.|..
 Worm   148 VDDPKSKTKAIDAKFANDPNYVGSAQEEEAIAKAIAASLADAEKQEKAKKSTSTMYPSAKASSPA 212

  Fly   145 VKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPATYVT 207
            |:....|||:. |:|||||...||.||.|..||:||:||.|:.:||.|.||.::|:||:::||
 Worm   213 VQTNSNIPEKN-VRALYDFEAAESNELSFVAGDIITITDESNPHWWTGRIGTQQGLFPSSFVT 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 4/17 (24%)
SH2_Grb2_like 56..149 CDD:199828 23/177 (13%)
SH3_GRB2_like_C 156..208 CDD:212739 28/52 (54%)
stam-1NP_491710.2 VHS_STAM 12..155 CDD:239625 26/136 (19%)
SH3 222..274 CDD:302595 26/52 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.