Sequence 1: | NP_476858.1 | Gene: | drk / 36497 | FlyBaseID: | FBgn0004638 | Length: | 211 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_491710.2 | Gene: | stam-1 / 172264 | WormBaseID: | WBGene00004109 | Length: | 457 | Species: | Caenorhabditis elegans |
Alignment Length: | 258 | Identity: | 59/258 - (22%) |
---|---|---|---|
Similarity: | 91/258 - (35%) | Gaps: | 96/258 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 NWYRAELDGKEGLIPSNYIEMKNHDWYYGRITRADAEKLLSNKHEGAFLIRIS------ESSPGD 93
Fly 94 FSLSVKCPDGVQHFKVL-----RDAQSKFFLWVVKF--------NSLNELVEYHRT--------- 136
Fly 137 ---------------------------------------------------------ASVSRSQD 144
Fly 145 VKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPATYVT 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drk | NP_476858.1 | SH3_GRB2_like_N | 2..53 | CDD:212738 | 4/17 (24%) |
SH2_Grb2_like | 56..149 | CDD:199828 | 23/177 (13%) | ||
SH3_GRB2_like_C | 156..208 | CDD:212739 | 28/52 (54%) | ||
stam-1 | NP_491710.2 | VHS_STAM | 12..155 | CDD:239625 | 26/136 (19%) |
SH3 | 222..274 | CDD:302595 | 26/52 (50%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R571 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |