DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and unc-57

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001122513.1 Gene:unc-57 / 172078 WormBaseID:WBGene00006791 Length:381 Species:Caenorhabditis elegans


Alignment Length:268 Identity:61/268 - (22%)
Similarity:96/268 - (35%) Gaps:86/268 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGRI 65
            ||...|.:|.    |.|:..:...||      |.|.:|.:|.|:.    .:|...|........:
 Worm   131 MEDNVKQNFL----DPLTHLQNNELK------DVNHHRTKLKGRR----LDYDCKKRQQRRDDEM 181

  Fly    66 TRADAEKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVK-FNSLNE 129
            .:|: |||..:|       |::|.|.  |::.....:.:...:.|.:||..|.....: ..:|.:
 Worm   182 IQAE-EKLEESK-------RLAEMSM--FNVLSNDVEQISQLRALIEAQLDFHRQTAQCLENLQQ 236

  Fly   130 LV------------EYHRTASV----SRSQDVKLRDMIPEEM----------------------- 155
            .:            |.|...||    ||:.....|...|.:|                       
 Worm   237 QLGHRIKDAAARPREEHVPLSVLANESRTPRSSFRSPAPSDMSHNSTAAAAFKMPPQNGGGITQA 301

  Fly   156 ----------------------LVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRK 198
                                  ..:||:||..|..|||||:.|.:|.:..:.||||:.|.:..:.
 Worm   302 PPSYQGPPPGGLPPPLSQQQKPQCRALFDFDAQSEGELDFKEGTLIELVSQIDENWYEGRVNGKT 366

  Fly   199 GIFPATYV 206
            |:||.|||
 Worm   367 GLFPVTYV 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 12/50 (24%)
SH2_Grb2_like 56..149 CDD:199828 21/109 (19%)
SH3_GRB2_like_C 156..208 CDD:212739 23/51 (45%)
unc-57NP_001122513.1 BAR_Endophilin_A 25..245 CDD:153276 29/137 (21%)
SH3_Endophilin_A 323..377 CDD:212737 23/52 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R571
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.