Sequence 1: | NP_476858.1 | Gene: | drk / 36497 | FlyBaseID: | FBgn0004638 | Length: | 211 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001122513.1 | Gene: | unc-57 / 172078 | WormBaseID: | WBGene00006791 | Length: | 381 | Species: | Caenorhabditis elegans |
Alignment Length: | 268 | Identity: | 61/268 - (22%) |
---|---|---|---|
Similarity: | 96/268 - (35%) | Gaps: | 86/268 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGRI 65
Fly 66 TRADAEKLLSNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVK-FNSLNE 129
Fly 130 LV------------EYHRTASV----SRSQDVKLRDMIPEEM----------------------- 155
Fly 156 ----------------------LVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRK 198
Fly 199 GIFPATYV 206 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drk | NP_476858.1 | SH3_GRB2_like_N | 2..53 | CDD:212738 | 12/50 (24%) |
SH2_Grb2_like | 56..149 | CDD:199828 | 21/109 (19%) | ||
SH3_GRB2_like_C | 156..208 | CDD:212739 | 23/51 (45%) | ||
unc-57 | NP_001122513.1 | BAR_Endophilin_A | 25..245 | CDD:153276 | 29/137 (21%) |
SH3_Endophilin_A | 323..377 | CDD:212737 | 23/52 (44%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R571 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |