DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and Lck

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_001155904.1 Gene:Lck / 16818 MGIID:96756 Length:520 Species:Mus musculus


Alignment Length:150 Identity:53/150 - (35%)
Similarity:82/150 - (54%) Gaps:18/150 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAE--LDGKEGLIPSNYIEMKN----HDWYY 62
            ||.|.:..:.|.:|.|.|.:.|:||  |....|::|:  ..|:||.||.|::...|    ..|::
Mouse    78 IALHSYEPSHDGDLGFEKGEQLRIL--EQSGEWWKAQSLTTGQEGFIPFNFVAK
ANSLEPEPWFF 140

  Fly    63 GRITRADAEKLL---SNKHEGAFLIRISESSPGDFSLSVKCPDG-----VQHFKVLRDAQSKFFL 119
            ..::|.|||:.|   .|.| |:||||.|||:.|.|||||:..|.     |:|:|:.......|::
Mouse   141 KNLSRKDAERQLLAPGNTH-GSFLIRESESTAGSFSLSVRDFDQNQGEVVKHYKIRNLDNGGFYI 204

  Fly   120 WV-VKFNSLNELVEYHRTAS 138
            .. :.|..|::||.::..||
Mouse   205 SPRITFPGLHDLVRHYTNAS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 19/50 (38%)
SH2_Grb2_like 56..149 CDD:199828 33/95 (35%)
SH3_GRB2_like_C 156..208 CDD:212739
LckNP_001155904.1 SH3_Lck 76..129 CDD:212938 19/52 (37%)
SH2_Src_Lck 134..234 CDD:198225 32/91 (35%)
PTKc_Lck_Blk 248..511 CDD:270652
Pkinase_Tyr 256..505 CDD:285015
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.