DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and LOC1273258

DIOPT Version :10

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_061507028.1 Gene:LOC1273258 / 1273258 VectorBaseID:AGAMI1_012797 Length:1261 Species:Anopheles gambiae


Alignment Length:75 Identity:32/75 - (42%)
Similarity:42/75 - (56%) Gaps:5/75 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   138 SVSRSQDVKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVITV--TDRS---DENWWNGEIGNR 197
            |.||.|..:.:|.:....|..|.||:..|...||..|.|.::.|  ||.|   ||.||.|:||:|
Mosquito    10 SGSREQRDQQQDWVMMSPLWTARYDYEAQGDDELSLRVGQIVYVLSTDSSISGDEGWWTGKIGDR 74

  Fly   198 KGIFPATYVT 207
            .||||:.:||
Mosquito    75 VGIFPSNFVT 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..149 CDD:199828 4/10 (40%)
SH3_GRB2_like_C 156..208 CDD:212739 27/57 (47%)
LOC1273258XP_061507028.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.