DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and GRAP

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_006604.1 Gene:GRAP / 10750 HGNCID:4562 Length:217 Species:Homo sapiens


Alignment Length:219 Identity:119/219 - (54%)
Similarity:150/219 - (68%) Gaps:12/219 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MEAIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAELDGKEGLIPSNYIEMKNHDWYYGRI 65
            ||::|.:.|.||..|||:|.|...|||||||||.|||:|||.|.||.||.|||.:|.|.||.|||
Human     1 MESVALYSFQATESDELAFNKGDTLKILNMEDDQNWYKAELRGVEGFIPKNYIRVKPHPWYSGRI 65

  Fly    66 TRADAEKLLSNK-HEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNE 129
            :|..||::|..: |.||||||.||||||:||:||...|.||||||||:|..|:|||..|||||||
Human    66 SRQLAEEILMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSLNE 130

  Fly   130 LVEYHRTASVSRSQDVKLRDMIPEEMLV--------QALYDFVPQESGELDFRRGDVITVTDRSD 186
            ||:::||.::::.:.:.|||   ||.|:        ||.:||..|:..:|.|||||:|.|.:|.|
Human   131 LVDFYRTTTIAKKRQIFLRD---EEPLLKSPGACFAQAQFDFSAQDPSQLSFRRGDIIEVLERPD 192

  Fly   187 ENWWNGEIGNRKGIFPATYVTPYH 210
            .:||.|....|.|.||.:||.|.|
Human   193 PHWWRGRSCGRVGFFPRSYVQPVH 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 31/50 (62%)
SH2_Grb2_like 56..149 CDD:199828 54/93 (58%)
SH3_GRB2_like_C 156..208 CDD:212739 25/59 (42%)
GRAPNP_006604.1 SH3_GRAP_N 2..55 CDD:212881 33/52 (63%)
SH2_Grb2_like 56..150 CDD:199828 54/93 (58%)
SH3_GRAP_C 162..214 CDD:212884 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46063
OrthoDB 1 1.010 - - D1091250at2759
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46037
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X588
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.