DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and STAM2

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:NP_005834.4 Gene:STAM2 / 10254 HGNCID:11358 Length:525 Species:Homo sapiens


Alignment Length:134 Identity:44/134 - (32%)
Similarity:65/134 - (48%) Gaps:12/134 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNELVEYH-RTAS 138
            |.|.||     |:....|..::|....:|....|...|......:.:    ||.|..:.| .|.|
Human   135 SMKEEG-----ITFPPAGSQTVSAAAKNGTSSNKNKEDEDIAKAIEL----SLQEQKQQHTETKS 190

  Fly   139 VSRSQDVKLRDMIPEEMLVQALYDFVPQESGELDFRRGDVITVTDRSDENWWNGEIGNRKGIFPA 203
            :..|.:::|.:.:..:  |:|||||...|..||.|:.|::|.|.|.||.|||.||.....|:||:
Human   191 LYPSSEIQLNNKVARK--VRALYDFEAVEDNELTFKHGEIIIVLDDSDANWWKGENHRGIGLFPS 253

  Fly   204 TYVT 207
            .:||
Human   254 NFVT 257

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738
SH2_Grb2_like 56..149 CDD:199828 18/74 (24%)
SH3_GRB2_like_C 156..208 CDD:212739 26/52 (50%)
STAM2NP_005834.4 VHS_STAM 9..143 CDD:239625 5/12 (42%)
PxVxL motif 54..67
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 143..167 4/23 (17%)
UIM 166..181 CDD:280900 3/18 (17%)
SH3_STAM2 204..260 CDD:212896 26/56 (46%)