DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and hck

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_005174178.1 Gene:hck / 101885596 ZFINID:ZDB-GENE-090313-72 Length:499 Species:Danio rerio


Alignment Length:190 Identity:60/190 - (31%)
Similarity:106/190 - (55%) Gaps:21/190 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AIAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAEL--DGKEGLIPSNYI---EMKNHDWYY 62
            |||.:|:.|..:.:|.|:|...|:||  ::...|::|.:  .|:||.|||||:   .::..:|::
Zfish    57 AIALYDYEAMHEGDLGFKKGDRLRIL--QESGEWWKAVIISTGQEGFIPSNYVAKDTLETEEWFF 119

  Fly    63 GRITRADAEK--LLSNKHEGAFLIRISESSPGDFSLSVK----CPDGVQHFKVLRDAQSKFFLWV 121
            ..::|.|||:  |.|....|:|:||.||::.|.:||||:    ..|.|:|:|:.......|::..
Zfish   120 KGVSRKDAERQLLASGNKTGSFMIRDSETTKGSYSLSVRDSDHQADTVKHYKIRTLDNGGFYISP 184

  Fly   122 -VKFNSLNELVEYHRTASVSRSQDVKLRDMIPEEMLVQALYD----FVPQESGELDFRRG 176
             :.||:|.:||.:::..|....|.:....:.|:.   |..::    .:|:||.:||.|.|
Zfish   185 RITFNTLQDLVSHYKKQSDGLCQSLTSPCLSPKP---QKPWEKDAWEIPRESLKLDKRLG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 20/51 (39%)
SH2_Grb2_like 56..149 CDD:199828 30/99 (30%)
SH3_GRB2_like_C 156..208 CDD:212739 8/25 (32%)
hckXP_005174178.1 SH3 58..109 CDD:302595 20/52 (38%)
SH2 113..215 CDD:301589 30/101 (30%)
PTKc_Hck 222..487 CDD:270658 7/20 (35%)
Pkinase_Tyr 234..484 CDD:285015 4/8 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.