DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and sla2

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_002939613.1 Gene:sla2 / 100495864 XenbaseID:XB-GENE-6257915 Length:269 Species:Xenopus tropicalis


Alignment Length:236 Identity:58/236 - (24%)
Similarity:103/236 - (43%) Gaps:54/236 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAE--LDGKEGLIPSNYIEMKNHDWYYGRIT 66
            :|.::|......:||.|..:.|.||:  :|.:|.:..  ..|.|..:|:||:....:.|.|..|.
 Frog    36 VALYNFPLGGQTDLSIRFGEQLNILS--EDGDWLKVSSLSTGHECYLPTNYVAKVCNRWLYRGIN 98

  Fly    67 RADAEKLL--SNKHEGAFLIRISESSPGDFSLSVK-----CPDGVQHFKVLRDAQSKFFLWV-VK 123
            |..||:||  ::...|:||||.||:..|.::||::     ..|.::|:::.:.....|::.. :.
 Frog    99 REKAEELLMVNSNQSGSFLIRESETRSGSYTLSIRKTSQSSRDSIKHYRIHQLDNGWFYIAPRLT 163

  Fly   124 FNSLNELVEYH-----------RTASVSR--SQDVKLRDMIPEEMLVQALYDFVPQESGELD-FR 174
            |.:|.::|:|:           |.|.|.:  |..|..|   |.|.:|........:|...|| |.
 Frog   164 FATLQDMVDYYSEVADGICCT
LREACVVQRVSNPVIQR---PSEPIVVRKPTLNWKELDSLDLFN 225

  Fly   175 RGDVI-------------------------TVTDRSDENWW 190
            :.|.:                         ::|:...|:||
 Frog   226 KEDKLNEDCPVSLGLREAVSSYMLMTQDSDSMTEVEKEHWW 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 14/50 (28%)
SH2_Grb2_like 56..149 CDD:199828 30/113 (27%)
SH3_GRB2_like_C 156..208 CDD:212739 10/61 (16%)
sla2XP_002939613.1 SH3_SLAP2 34..88 CDD:212944 15/53 (28%)
SH2_SLAP 81..184 CDD:198207 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.