DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and frk

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_002938349.1 Gene:frk / 100488362 XenbaseID:XB-GENE-492884 Length:517 Species:Xenopus tropicalis


Alignment Length:142 Identity:49/142 - (34%)
Similarity:83/142 - (58%) Gaps:12/142 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IAKHDFSATADDELSFRKTQILKILNMEDDSNWYRAEL---DGK-EGLIPSNYI----EMKNHDW 60
            :|.:.:.....|||||:....:.|:: ...::|::|:|   .|| ||.:|.||:    .:::..|
 Frog    66 VALYSYEGRTPDELSFKAGDQMLIID-TTHASWWKAKLLRTRGKAEGYVPFNY
VAPVSSIESMPW 129

  Fly    61 YYGRITRADAEKLL--SNKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLW-VV 122
            ::..|.|::||:||  .....|:||||.|||..|::||||.....|:|:::.:.....|::. ..
 Frog   130 FFKDIKRSEAERLLVRPGNTTGSFLIRESESQKGEYSLSVFDGIAVKHYRLRKLDDGGFYITSKS 194

  Fly   123 KFNSLNELVEYH 134
            ||.|:||||||:
 Frog   195 KFVSMNELVEYY 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 16/52 (31%)
SH2_Grb2_like 56..149 CDD:199828 32/82 (39%)
SH3_GRB2_like_C 156..208 CDD:212739
frkXP_002938349.1 SH3_Src_like 65..117 CDD:212779 15/51 (29%)
SH2 125..220 CDD:387587 32/82 (39%)
PTKc_Frk_like 238..505 CDD:270653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.