DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drk and si:ch73-340m8.2

DIOPT Version :9

Sequence 1:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster
Sequence 2:XP_002665190.3 Gene:si:ch73-340m8.2 / 100332982 ZFINID:ZDB-GENE-110411-209 Length:480 Species:Danio rerio


Alignment Length:167 Identity:41/167 - (24%)
Similarity:80/167 - (47%) Gaps:32/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ELSFRKTQILKILNMEDDSNWY-----RAELD------GKEGLIPSNYIE----MKNHDWYYGRI 65
            :|:.||..||::..  :...|.     .|:.|      .:.|.:|.::::    ::...||:..:
Zfish    46 DLNLRKGDILEVTG--ETEYWLYVRRRTAKTDKSKSFIEEHGYVPKDFVKPLDSVEAEPWYFENV 108

  Fly    66 -TRADAEKLL---SNKHEGAFLI-RISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWV--VK 123
             ||.:|::.|   .|| |||||: :..|::  .:.||||.....:|:::.:....:.|..|  ..
Zfish   109 KTRVEAKRCLLRPENK-EGAFLVWKCDENN--HYYLSVKNGPHARHYRIKQGENDQQFFLVHHTT 170

  Fly   124 FNSLNELVEY---HRTASVSRSQD--VKLRDMIPEEM 155
            |.||.:|:|:   |.....::..:  |||...:|:.:
Zfish   171 FQSLRKLIEFYSKHEGGLCAKLHEACVKLDQPVPQTL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 10/47 (21%)
SH2_Grb2_like 56..149 CDD:199828 30/104 (29%)
SH3_GRB2_like_C 156..208 CDD:212739 41/167 (25%)
si:ch73-340m8.2XP_002665190.3 SH2 99..192 CDD:301589 27/95 (28%)
Pkinase_Tyr 220..468 CDD:285015
PKc_like 225..468 CDD:304357
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000006
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.