DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and CSE4

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_012875.2 Gene:CSE4 / 853817 SGDID:S000001532 Length:229 Species:Saccharomyces cerevisiae


Alignment Length:199 Identity:58/199 - (29%)
Similarity:91/199 - (45%) Gaps:33/199 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LTLQDNNRRSSTL--RRDAGRRQPAAR-DSSTSGEEEDQE-NRYPTTRSPQTRRMTVQQESKTRA 108
            |:|....|.:..|  ||:..||..::: |.....:.|||. |....|.:.:      :.|.:|..
Yeast    39 LSLLQRTRATKNLFPRREERRRYESSKSDLDIETDYEDQAGNLEIETENEE------EAEMETEV 97

  Fly   109 AGPVAAQN--------QTRRRKAANPMSRAKRMDR----------EIRRLQHHPGTLIPKLPFSR 155
            ..||...:        |.||.|...  ...||:::          |||:.|.....||.|:||:|
Yeast    98 PAPVRTHSYALDRYVRQKRREKQRK--QSLKRVEKKYTPSELALYEIRKYQRSTDLLISKIPFAR 160

  Fly   156 LVREFIVKY-SDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMALMAYIC 219
            ||:|...:: :.|:.||....|::|:||:.|.||...|..:.:|..|..|:|:..:||.|...| 
Yeast   161 LVKEVTDEFTTKDQDLRWQSMAIMALQEASEAYLVGLLEHTNLLALHAKRITIMKKDMQLARRI- 224

  Fly   220 DRGR 223
             ||:
Yeast   225 -RGQ 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 31/94 (33%)
CSE4NP_012875.2 H3 124..229 CDD:128705 36/106 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I1774
Isobase 1 0.950 - 0.704428 Normalized mean entropy S10
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.