DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and HTR12

DIOPT Version :9

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_001030927.1 Gene:HTR12 / 839104 AraportID:AT1G01370 Length:178 Species:Arabidopsis thaliana


Alignment Length:160 Identity:52/160 - (32%)
Similarity:72/160 - (45%) Gaps:11/160 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 AGRRQPAARDSSTSGEEEDQENRYPTTRSPQTRRMTVQQESKTRAAGPVAAQNQTRRRKAANPMS 128
            ||......|.....|:...|.|  ||| ||.|.  |.:...::|.|.|..:|.::.|.:   |.:
plant    28 AGPTTTPTRRGGEGGDNTQQTN--PTT-SPATG--TRRGAKRSRQAMPRGSQKKSYRYR---PGT 84

  Fly   129 RAKRMDREIRRLQHHPGTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLA 193
            .|.   :|||..|.....|||...|.|.||......:..:..|.|..||:|:||:.|.||....:
plant    85 VAL---KEIRHFQKQTNLLIPAASFIREVRSITHMLAPPQINRWTAEALVALQEAAEDYLVGLFS 146

  Fly   194 DSYMLTKHRNRVTLEVRDMALMAYICDRGR 223
            ||.:...|..||||..:|..|...:..:||
plant   147 DSMLCAIHARRVTLMRKDFELARRLGGKGR 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 H4 135..219 CDD:419976 30/83 (36%)
HTR12NP_001030927.1 H4 72..173 CDD:390056 34/106 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1745
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG60295
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11426
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.