DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and MGH3

DIOPT Version :10

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_173418.1 Gene:MGH3 / 838577 AraportID:AT1G19890 Length:137 Species:Arabidopsis thaliana


Alignment Length:145 Identity:50/145 - (34%)
Similarity:68/145 - (46%) Gaps:22/145 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RSPQTRRMTV-----QQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMD------REIRRLQHHP 144
            |:.||.|.:.     ::|..|:||       :..||.....:.||.|..      ||||:.|...
plant     3 RTKQTARKSTGGKGPRKELATKAA-------RKTRRPYRGGVKRAHRFRPGTVALREIRKYQKST 60

  Fly   145 GTLIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEV 209
            ..||.||||.|||||....:..|  ||....|:||:||:.|.||.....|:.:...|..|||:..
plant    61 DLLIRKLPFQRLVREIAQDFKVD--LRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMS 123

  Fly   210 RDMALMAYICDRGRQ 224
            :|:.|...|  ||.:
plant   124 KDIQLARRI--RGER 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 HFD_SF 126..219 CDD:480273 37/98 (38%)
MGH3NP_173418.1 PTZ00018 1..137 CDD:185400 50/145 (34%)

Return to query results.
Submit another query.