DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and AT1G13370

DIOPT Version :10

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_172794.1 Gene:AT1G13370 / 837897 AraportID:AT1G13370 Length:136 Species:Arabidopsis thaliana


Alignment Length:133 Identity:43/133 - (32%)
Similarity:61/133 - (45%) Gaps:17/133 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RSPQTRRMTVQQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMD---------REIRRLQHHPGT 146
            |:.|:.|.:...::.|:.....||      ||:|......|:..         ||||:.|.....
plant     3 RTKQSARKSHGGKAPTKQLATKAA------RKSAPTTGGVKKPHRFRPGTVALREIRKYQKSTEL 61

  Fly   147 LIPKLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRD 211
            |..||||.|||||....:..|  ||....|:||:||:.|.||.....|:.:...|..|||:..:|
plant    62 LNRKLPFQRLVREIAQDFKTD--LRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKD 124

  Fly   212 MAL 214
            :.|
plant   125 VQL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 HFD_SF 126..219 CDD:480273 34/98 (35%)
AT1G13370NP_172794.1 PTZ00018 1..136 CDD:185400 43/133 (32%)

Return to query results.
Submit another query.