DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cid and HTR11

DIOPT Version :10

Sequence 1:NP_523730.2 Gene:cid / 36495 FlyBaseID:FBgn0040477 Length:225 Species:Drosophila melanogaster
Sequence 2:NP_201338.1 Gene:HTR11 / 836660 AraportID:AT5G65350 Length:139 Species:Arabidopsis thaliana


Alignment Length:140 Identity:43/140 - (30%)
Similarity:65/140 - (46%) Gaps:13/140 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RSPQTRRMTVQQESKTRAAGPVAAQNQTRRRKAANPMSRAKRMD------REIRRLQHHPGTLIP 149
            |:.||.|::...::..:...|.||:...   .|...:.:..|..      |:||:.|.....||.
plant     3 RTKQTARISTGGKAPRKQLAPKAARQSA---PATGGVKKPHRFRPGTVALRDIRKYQKSTEILIR 64

  Fly   150 KLPFSRLVREFIVKYSDDEPLRVTEGALLAMQESCEMYLTQRLADSYMLTKHRNRVTLEVRDMAL 214
            ||||.|||||....:..|  ||....|:.|:||:.|.||.....|:.:...|..|||:..:::.|
plant    65 KLPFQRLVREIAQDFKTD--LRFQSSAVAALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKEIQL 127

  Fly   215 MAYICDRGRQ 224
            ...|  ||.:
plant   128 ARRI--RGER 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
cidNP_523730.2 HFD_SF 126..219 CDD:480273 32/98 (33%)
HTR11NP_201338.1 PTZ00018 1..136 CDD:185400 43/140 (31%)

Return to query results.
Submit another query.